Sequence 1: | NP_523855.1 | Gene: | CG3594 / 37964 | FlyBaseID: | FBgn0035063 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015437.1 | Gene: | MRD1 / 856228 | SGDID: | S000006316 | Length: | 887 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 207 | Identity: | 56/207 - (27%) |
---|---|---|---|
Similarity: | 93/207 - (44%) | Gaps: | 28/207 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 TVNDDSADLLGNFDDQKRREIFEGTYVDKEDGRNPSDPEDSKSED------EAKSDDEAAAEGSA 81
Fly 82 ASGAEEEESAENGQITSDQLSSLLRGASKTNRH--VLYVTNLNFETTKDDLELHFSAAGTVKSIR 144
Fly 145 IPK---KRRGGFAFVEMADLSSFQNAF-QLHNTELQGRNIKVQISE-----AGKKKSANKKNIIK 200
Fly 201 Q-KNRKLAEMRN 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3594 | NP_523855.1 | RRM3_Prp24 | 114..184 | CDD:240744 | 29/75 (39%) |
MRD1 | NP_015437.1 | RRM4_MRD1 | 663..746 | CDD:409758 | 14/81 (17%) |
RRM5_MRD1 | 763..837 | CDD:241014 | 29/73 (40%) | ||
RRM1_RBM19_MRD1 | 2..92 | CDD:409754 | |||
RRM | 222..612 | CDD:223796 | |||
RRM2_MRD1 | 343..421 | CDD:409982 | |||
RRM3_MRD1 | 532..603 | CDD:241012 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0110 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |