DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and MRD1

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_015437.1 Gene:MRD1 / 856228 SGDID:S000006316 Length:887 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:56/207 - (27%)
Similarity:93/207 - (44%) Gaps:28/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TVNDDSADLLGNFDDQKRREIFEGTYVDKEDGRNPSDPEDSKSED------EAKSDDEAAAEGSA 81
            |.|.:..|         |.::|.| :|..:....|......|:..      |.::.::|.|..:|
Yeast   674 TTNQNLTD---------RFKVFTG-FVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAA 728

  Fly    82 ASGAEEEESAENGQITSDQLSSLLRGASKTNRH--VLYVTNLNFETTKDDLELHFSAAGTVKSIR 144
            ..|...:......:::..|.|......:|:|:.  .:.|.||.||.|:.|:...|::.|.:||:|
Yeast   729 MDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKIIVKNLPFEATRKDVFELFNSFGQLKSVR 793

  Fly   145 IPK---KRRGGFAFVEMADLSSFQNAF-QLHNTELQGRNIKVQISE-----AGKKKSANKKNIIK 200
            :||   |...||||||.......:||. |||...|.||.:.:|.:|     |.::.:...|.:.|
Yeast   794 VPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQYAEEDAVDAEEEIARMTKKVRK 858

  Fly   201 Q-KNRKLAEMRN 211
            | ...::|.:||
Yeast   859 QVATNEMAALRN 870

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 29/75 (39%)
MRD1NP_015437.1 RRM4_MRD1 663..746 CDD:409758 14/81 (17%)
RRM5_MRD1 763..837 CDD:241014 29/73 (40%)
RRM1_RBM19_MRD1 2..92 CDD:409754
RRM 222..612 CDD:223796
RRM2_MRD1 343..421 CDD:409982
RRM3_MRD1 532..603 CDD:241012
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.