DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and PUB1

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_014382.1 Gene:PUB1 / 855716 SGDID:S000004961 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:145 Identity:38/145 - (26%)
Similarity:69/145 - (47%) Gaps:15/145 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PSDPEDSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQL---SSLLRGASKTNRHVLYV 118
            ||..|...|.|.: |:...|.||::       |.||:.|..:|..   ::.:.|..:|:..||||
Yeast    23 PSAVEAPASADPS-SEQSVAVEGNS-------EQAEDNQGENDPSVVPANAITGGRETSDRVLYV 79

  Fly   119 TNLNFETTKDDLELHFSAAGTVKSIRI---PKKRRGGFAFVEMADLSSFQNAFQ-LHNTELQGRN 179
            .||:...|:|.|:.:|...|.:.:|:|   ...:...:||||.........|.| |:..:::...
Yeast    80 GNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNI 144

  Fly   180 IKVQISEAGKKKSAN 194
            :|:..:...::.|::
Yeast   145 VKINWAFQSQQSSSD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 38/145 (26%)
RRM 116..187 CDD:440488 20/74 (27%)
PUB1NP_014382.1 RRM1_PUB1 77..150 CDD:410026 20/72 (28%)
RRM2_PUB1 161..240 CDD:410031
RRM3_PUB1 341..414 CDD:410033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.