DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and CSTF64

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_177325.2 Gene:CSTF64 / 843510 AraportID:AT1G71800 Length:461 Species:Arabidopsis thaliana


Alignment Length:90 Identity:25/90 - (27%)
Similarity:43/90 - (47%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ASKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRR----GGFAFVEMAD----LSSF 164
            :|.:.|..::|.|:.::.|::.|.......|.|.|.|:...|.    .|:.|.|..|    ||:.
plant     3 SSSSQRRCVFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSAR 67

  Fly   165 QNAFQLHNTELQGRNIKVQISEAGK 189
            :|   |.:.|:.||.::|..:|..|
plant    68 RN---LQSYEINGRQLRVDFAENDK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 25/90 (28%)
RRM 116..187 CDD:440488 21/78 (27%)
CSTF64NP_177325.2 RRM_CSTF2_RNA15_like 9..85 CDD:409832 21/78 (27%)
SF-CC1 <11..212 CDD:273721 23/82 (28%)
CSTF_C 419..454 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.