DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and AT5G40490

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_198865.1 Gene:AT5G40490 / 834047 AraportID:AT5G40490 Length:423 Species:Arabidopsis thaliana


Alignment Length:142 Identity:33/142 - (23%)
Similarity:52/142 - (36%) Gaps:36/142 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GTYVDKEDGRNPSDPEDSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRGASK 110
            ||....||     :..|.|..::.:.||            ::.:....|.:.|         |.|
plant     5 GTETVIED-----EIHDPKPSEDIEDDD------------DKSQPHSGGGVDS---------AGK 43

  Fly   111 TNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRR----GGFAFVEMADLSSFQNAFQLH 171
                 ::|..|..|||..:...||...|.:....|.|.|:    .||.||..||.|......| .
plant    44 -----IFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQ-D 102

  Fly   172 NTELQGRNIKVQ 183
            |..:.|:.::::
plant   103 NHIIIGKQVEIK 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 33/142 (23%)
RRM 116..187 CDD:440488 21/72 (29%)
AT5G40490NP_198865.1 RRM_SF 44..114 CDD:473069 21/70 (30%)
RRM_SF 131..209 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.