DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and AT4G19610

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_193696.3 Gene:AT4G19610 / 827703 AraportID:AT4G19610 Length:816 Species:Arabidopsis thaliana


Alignment Length:112 Identity:42/112 - (37%)
Similarity:61/112 - (54%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LYVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRRG---GFAFVEMADLSSFQNAFQ-LHNTELQ 176
            |:|.|:.||.||.:|...||..|.:||:|:|||..|   |:||||........||.: |.:|...
plant   704 LHVKNIAFEATKRELRQLFSPFGQIKSMRLPKKNIGQYAGYAFVEFVTKQEALNAKKALASTHFY 768

  Fly   177 GRNIKVQIS------EAGKKKSANK-----KNIIKQKNRKLAEMRNE 212
            ||::.::.:      ||.:|:||.|     .|..|:|:.|..|.:||
plant   769 GRHLVLEWANDDNSMEAIRKRSAAKFDEENDNARKRKSSKAVEGKNE 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 35/95 (37%)
RRM 116..187 CDD:440488 29/80 (36%)
AT4G19610NP_193696.3 RRM1_MRD1 2..77 CDD:409981
PABP-1234 4..>403 CDD:130689
RRM3_RBM19_RRM2_MRD1 295..368 CDD:409755
RRM4_RBM19_RRM3_MRD1 488..559 CDD:409756
RRM5_RBM19_like 602..683 CDD:409757
RRM6_RBM19_RRM5_MRD1 702..777 CDD:409759 29/72 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.