DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and CP29

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:165 Identity:44/165 - (26%)
Similarity:61/165 - (36%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KRREIF-----EGTYVDKEDGRNPSDPEDSKSEDE--AKSDDEAAAEGSAAS----GAEEEESAE 92
            ||.|.|     .|.|..:..|...|:.......:.  ....:.....||..|    |..:..|..
plant   201 KREESFSRGPRSGGYGSERGGGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYG 265

  Fly    93 NGQITSDQLSSLLRGASKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRI----PKKRRGGF 153
            :|       |....|:...||  |||.||::......||..|:..|.|...|:    ...|..||
plant   266 SG-------SGSGSGSGSGNR--LYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGF 321

  Fly   154 AFVEMADLSSFQNAF-QLHNTELQGRNIKVQISEA 187
            .||.::.....|.|. .|:..:|.||.|:|..:||
plant   322 GFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEA 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 44/165 (27%)
RRM 116..187 CDD:440488 24/75 (32%)
CP29NP_001190079.1 U2AF_lg <45..>144 CDD:273727
RRM_SF 100..199 CDD:473069
RRM 278..361 CDD:440488 28/81 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.