DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and AT3G06970

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_187353.2 Gene:AT3G06970 / 819882 AraportID:AT3G06970 Length:317 Species:Arabidopsis thaliana


Alignment Length:122 Identity:28/122 - (22%)
Similarity:43/122 - (35%) Gaps:27/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 INVQPIRTHHSGSVSATTMGHTTVTPNTPATTIQSSVSATANQVAATGLAKDCAGCGKRITERFL 65
            ||.:.:...:..:.|...:....:.||.|... .|..||.:...|:      |.|.|.:...|..
plant   122 INKEQVEGRNCSNYSVRFLCPVVIHPNIPEQP-WSEWSAWSKCSAS------CGGNGMQTRTRKC 179

  Fly    66 LKALDIFWHEDC------------LKCGCCD--CRLGEVGSTLYTKANLILCKRDYL 108
            |  .:..|.|.|            ..|..||  |.:|:|.:    ..|:.:||...|
plant   180 L--AEEQWQEHCNGPTEEGRRCAGNTCAVCDLSCPIGKVSA----DCNMCVCKTHIL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 21/87 (24%)
RRM 116..187 CDD:440488
AT3G06970NP_187353.2 PABP-1234 <3..182 CDD:130689 15/68 (22%)
RRM_SF 12..87 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.