DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and AT2G43370

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_850395.1 Gene:AT2G43370 / 818938 AraportID:AT2G43370 Length:333 Species:Arabidopsis thaliana


Alignment Length:98 Identity:24/98 - (24%)
Similarity:41/98 - (41%) Gaps:21/98 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LYVTNLNFETTKDDLELHFSAAGTVKSIRIPKK----RRGGFAFVEMADLSSFQNAFQ-LHNTEL 175
            |:|..|:..||:|.|....|..|.:|::|:.:.    ...|:.|||.........|:: .|::.:
plant    66 LFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDAHHSLI 130

  Fly   176 QGRNIKVQISE----------------AGKKKS 192
            .||.|.|..:.                .|:|:|
plant   131 DGREIIVDYNRQQLMPGWIPRRLGGGLGGRKES 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 24/98 (24%)
RRM 116..187 CDD:440488 21/91 (23%)
AT2G43370NP_850395.1 RRM_snRNP35 60..150 CDD:409683 21/83 (25%)
U2AF_lg 218..>324 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.