DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and Eif4b

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_663600.2 Gene:Eif4b / 75705 MGIID:95304 Length:611 Species:Mus musculus


Alignment Length:141 Identity:31/141 - (21%)
Similarity:61/141 - (43%) Gaps:34/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 KTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRIPKK-----RRGGFAFVEMADLSSFQNAFQ 169
            |:..:..::.||.::.|:|.::..|... .:.::|:|::     |..||.:.|..||.|..:|..
Mouse    92 KSPPYTAFLGNLPYDVTEDSIKDFFRGL-NISAVRLPREPSNPDRLKGFGYAEFEDLDSLLSALS 155

  Fly   170 LHNTELQGRNIKVQISEAGKKKSANKKNIIKQKNRKLAEMRNEQKTFTKSGKFYDKDLKKEKAKE 234
            |:...|..|.|:|.:::..:.|..:.::..:.:|      |:..||        |.|        
Mouse   156 LNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRN------RDSDKT--------DTD-------- 198

  Fly   235 MLARKRWRKKP 245
                  ||.:|
Mouse   199 ------WRARP 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 22/91 (24%)
RRM 116..187 CDD:440488 20/75 (27%)