DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and Rbm34

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_766350.2 Gene:Rbm34 / 52202 MGIID:1098653 Length:442 Species:Mus musculus


Alignment Length:278 Identity:81/278 - (29%)
Similarity:126/278 - (45%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASDSGSDYEVEAFFNPKRVQRTVNDDSADLLGNF----DDQKRREIF----------------- 44
            :|.|.|...::..  ||:. :|..|:.:. .:||.    :.:|.:..|                 
Mouse   166 LAKDGGQRTKIPV--NPEE-ERLKNERTV-FVGNLPVTCNKKKLKSFFKEYGQVESVRFRSVMPA 226

  Fly    45 EGTYVDKEDGRNPSDPEDSKSEDE--AKSDDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRG 107
            |||...|..........|.||.:.  ...|:.|||:....:||   :.||..:|..|..|..   
Mouse   227 EGTLTKKLAAIKRKFHPDQKSINAYVVFKDESAAAKALQRNGA---QIAEGFRIRVDLASET--- 285

  Fly   108 ASKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRI---PKKRRG-GFAFVEMADLSSFQNAF 168
            ||:..|.| :|.||.::.....||.||...|::.::||   |....| ||.:|...:..:...|.
Mouse   286 ASRDKRSV-FVGNLPYKIEDSALEEHFLDCGSIVAVRIVRNPLTGVGRGFGYVLFENTDAVHLAL 349

  Fly   169 QLHNTELQGRNIKVQIS---EAGKKKSAN---KKNIIKQKNRKLAEMRNEQKTFTKSGKFYDKD- 226
            :|:|:||.||.::|..|   |..|::::|   ||::||.|.| |.....|.|..:|.|||:.|: 
Mouse   350 KLNNSELMGRKLRVMRSVNKEKLKQQNSNPSLKKDVIKPKQR-LNFTSKEGKFHSKEGKFHSKNA 413

  Fly   227 LKKEKAKEMLARKRWRKK 244
            ...|||..|..:|:.:||
Mouse   414 FIGEKAVLMKKKKKGQKK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 24/73 (33%)
Rbm34NP_766350.2 RRM1_RBM34 189..280 CDD:240840 20/94 (21%)
RRM2_RBM34 292..364 CDD:240841 23/72 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2864
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.