DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and srsf1

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001006919.1 Gene:srsf1 / 448766 XenbaseID:XB-GENE-486875 Length:267 Species:Xenopus tropicalis


Alignment Length:89 Identity:27/89 - (30%)
Similarity:45/89 - (50%) Gaps:4/89 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LLRGASKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRRGG--FAFVEMADLSSFQN 166
            ::||.:..|...:||.||..:....|:|..|...|.::.|.: |.||||  |||||..|....::
 Frog     6 VIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDL-KNRRGGPPFAFVEFEDPRDAED 69

  Fly   167 A-FQLHNTELQGRNIKVQISEAGK 189
            | :.....:..|..::|:...:|:
 Frog    70 AVYGRDGYDYDGYRLRVEFPRSGR 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 27/89 (30%)
RRM 116..187 CDD:440488 23/73 (32%)
srsf1NP_001006919.1 RRM1_SRSF1 12..90 CDD:410010 24/78 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..137 1/4 (25%)
RRM2_SRSF1 132..215 CDD:410160
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..267
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.