DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and eIF4H2

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001263122.1 Gene:eIF4H2 / 43645 FlyBaseID:FBgn0039797 Length:459 Species:Drosophila melanogaster


Alignment Length:141 Identity:29/141 - (20%)
Similarity:56/141 - (39%) Gaps:27/141 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LGNFDDQKRREI-FEGTYVDKEDGRNPSDPEDSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQ 95
            :.|...|:.||. .:.||.:..|.|:.:  .|::...|.:|:.:....       .:.:.....|
  Fly     1 MANRSSQRDREFNRDNTYNNNRDNRDHN--RDNRDNRENRSNFQNYRN-------RDRDRDRQRQ 56

  Fly    96 ITSDQLSSLLRGASKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRR----GGFAFV 156
            :.::.            ..:.||.||.....:.|:...||.. .||::|:.|.|.    .|:.:|
  Fly    57 VPTEP------------PFIAYVGNLPKGLVQGDVMKIFSDF-EVKNVRLIKDRETDEFKGYGYV 108

  Fly   157 EMADLSSFQNA 167
            |...|:..::|
  Fly   109 EFETLAQLKSA 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 17/58 (29%)
eIF4H2NP_001263122.1 RRM <58..247 CDD:223796 17/75 (23%)
RRM_SF 62..140 CDD:302621 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.