DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and CG3335

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:198 Identity:43/198 - (21%)
Similarity:81/198 - (40%) Gaps:55/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PEDSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRGASKTNRHVLYVTNLNFE 124
            ||:....::||.|:    |.|.|..|::|.....                     .|::.||||:
  Fly   650 PEEKPIVNDAKPDE----EDSRAEDADDEPEPNT---------------------TLFLRNLNFK 689

  Fly   125 TTKDDLELHFSAAGTVKSIRIPKKRRG---------GFAFVEMADLSSFQNAFQ-LHNTELQG-- 177
            |.::.:|.||...|::.::.|.|:|..         |:.|::....|..::|.: |..|.:.|  
  Fly   690 TVQETVEKHFRHLGSIHTVEIAKRRDPENPREFKSLGYGFIQFKKSSVAEHALKNLQLTHIDGNP 754

  Fly   178 -------RNIKVQISEAGKKKSANKKNIIKQKNRKL--------AEMRNEQKTFTKSGKFYDKDL 227
                   |.:|.|.::..:::.|::|   ||...|:        |:.|..:..|...|:.....:
  Fly   755 VELKRSDRVLKTQDNDGAQRRLASQK---KQTGTKILVRNIPFQAQYREVRDIFKAFGELRSLRI 816

  Fly   228 KKE 230
            .|:
  Fly   817 PKK 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 34/155 (22%)
RRM 116..187 CDD:440488 23/89 (26%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:409980
PABP-1234 <245..>435 CDD:130689
RRM3_RBM19 362..440 CDD:409983
RRM4_RBM19 552..623 CDD:409984
PRK10819 <634..>680 CDD:236768 10/54 (19%)
RRM5_RBM19_like 679..760 CDD:409757 20/101 (20%)
RRM6_RBM19 785..864 CDD:409985 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.