Sequence 1: | NP_523855.1 | Gene: | CG3594 / 37964 | FlyBaseID: | FBgn0035063 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648337.1 | Gene: | CG3335 / 39119 | FlyBaseID: | FBgn0036018 | Length: | 918 | Species: | Drosophila melanogaster |
Alignment Length: | 198 | Identity: | 43/198 - (21%) |
---|---|---|---|
Similarity: | 81/198 - (40%) | Gaps: | 55/198 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 PEDSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRGASKTNRHVLYVTNLNFE 124
Fly 125 TTKDDLELHFSAAGTVKSIRIPKKRRG---------GFAFVEMADLSSFQNAFQ-LHNTELQG-- 177
Fly 178 -------RNIKVQISEAGKKKSANKKNIIKQKNRKL--------AEMRNEQKTFTKSGKFYDKDL 227
Fly 228 KKE 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3594 | NP_523855.1 | RRM3_Prp24 | 114..184 | CDD:240744 | 22/88 (25%) |
CG3335 | NP_648337.1 | RRM1_RBM19 | 2..77 | CDD:241008 | |
RRM_SF | 250..314 | CDD:302621 | |||
RRM3_RBM19 | 362..440 | CDD:241011 | |||
RRM4_RBM19 | 552..623 | CDD:241013 | |||
RRM | <638..845 | CDD:223796 | 43/198 (22%) | ||
RRM5_RBM19_like | 679..760 | CDD:240764 | 20/101 (20%) | ||
RRM6_RBM19 | 785..864 | CDD:241015 | 6/35 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0110 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |