DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and CG3335

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:198 Identity:43/198 - (21%)
Similarity:81/198 - (40%) Gaps:55/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PEDSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRGASKTNRHVLYVTNLNFE 124
            ||:....::||.|:    |.|.|..|::|.....                     .|::.||||:
  Fly   650 PEEKPIVNDAKPDE----EDSRAEDADDEPEPNT---------------------TLFLRNLNFK 689

  Fly   125 TTKDDLELHFSAAGTVKSIRIPKKRRG---------GFAFVEMADLSSFQNAFQ-LHNTELQG-- 177
            |.::.:|.||...|::.::.|.|:|..         |:.|::....|..::|.: |..|.:.|  
  Fly   690 TVQETVEKHFRHLGSIHTVEIAKRRDPENPREFKSLGYGFIQFKKSSVAEHALKNLQLTHIDGNP 754

  Fly   178 -------RNIKVQISEAGKKKSANKKNIIKQKNRKL--------AEMRNEQKTFTKSGKFYDKDL 227
                   |.:|.|.::..:::.|::|   ||...|:        |:.|..:..|...|:.....:
  Fly   755 VELKRSDRVLKTQDNDGAQRRLASQK---KQTGTKILVRNIPFQAQYREVRDIFKAFGELRSLRI 816

  Fly   228 KKE 230
            .|:
  Fly   817 PKK 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 22/88 (25%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 43/198 (22%)
RRM5_RBM19_like 679..760 CDD:240764 20/101 (20%)
RRM6_RBM19 785..864 CDD:241015 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0110
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.