DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and eIF4B

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:155 Identity:37/155 - (23%)
Similarity:65/155 - (41%) Gaps:24/155 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 VLYVTNLNFETTKDDLELHFSAAGTVKSIRIPKK-----RRGGFAFVEMADLSSFQNAFQLHNTE 174
            :.|:.||.|:..:|||...|.....: |:|:|::     |..||.:||:.:.....:...|.:..
  Fly    81 IAYINNLPFDANEDDLYEFFEGINLI-SLRLPREDGENGRSRGFGYVELENREDLIHVLSLPDPS 144

  Fly   175 LQGRNIKVQISEAGKKKSANKKNI------IKQKNRKLAEMR----NEQKTFTKSGKFYDKDLKK 229
            ::||.|::::|....::|..|.|.      ....||.....|    |....|..|..| ::...:
  Fly   145 IKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDSGNWRRDSQNNGSNFGYSSNF-ERSFNR 208

  Fly   230 EKAKEMLARK------RWRKKPAPR 248
            |: |.:..|.      .||....|:
  Fly   209 ER-KSLPDRDDVNTPGSWRTSARPQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 20/73 (27%)
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 37/155 (24%)
RRM_eIF4B 79..155 CDD:240848 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.