DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and TRA2A

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens


Alignment Length:195 Identity:37/195 - (18%)
Similarity:62/195 - (31%) Gaps:61/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DKEDGRNPSDPEDSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRGASKTNRH 114
            |.|:  |..:..:|:|:.::.:...|..:..:.||:...........:..:..|..|..|:.:.|
Human     3 DVEE--NNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSH 65

  Fly   115 VLY------------------------------------------------------VTNLNFET 125
            ..|                                                      |..|:..|
Human    66 RRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTCLGVFGLSLYT 130

  Fly   126 TKDDLELHFSAAGTVKSIRIPKKRR----GGFAFVEMADLSSFQNAFQLHN-TELQGRNIKVQIS 185
            |:.||...||..|.:..:.:...:|    .|||||....:...:.|.:..| .||.||.|:|..|
Human   131 TERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYS 195

  Fly   186  185
            Human   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 37/195 (19%)
RRM 116..187 CDD:440488 25/129 (19%)
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 13/116 (11%)
RRM_TRA2 118..197 CDD:409798 24/78 (31%)
Linker 198..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.