DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and RBMX

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_002130.2 Gene:RBMX / 27316 HGNCID:9910 Length:391 Species:Homo sapiens


Alignment Length:85 Identity:24/85 - (28%)
Similarity:42/85 - (49%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LYVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRR----GGFAFVEMADLSSFQNAFQ-LHNTEL 175
            |::..||.||.:..||..|...|.:..:.:.|.|.    .|||||.....:..::|.: ::...|
Human    10 LFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSL 74

  Fly   176 QGRNIKVQIS-----EAGKK 190
            .|:.|||:.:     |:|::
Human    75 DGKAIKVEQATKPSFESGRR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 24/85 (28%)
RRM 116..187 CDD:440488 22/80 (28%)
RBMXNP_002130.2 RRM_RBMX_like 7..86 CDD:409816 22/75 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..391 8/34 (24%)
dnaA 165..>306 CDD:455861
RBM1CTR 173..217 CDD:400429
Necessary for the association to nascent RNAPII transcripts and nuclear localization 186..236
Necessary for RNA-binding 333..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.