DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and SPBC365.04c

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_596033.1 Gene:SPBC365.04c / 2540924 PomBaseID:SPBC365.04c Length:233 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:59/210 - (28%)
Similarity:107/210 - (50%) Gaps:24/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DQKRREIFEGTYVDKEDGRNPSDPEDSKSEDEAKSDDEAAAEGSAASGAEEEESAENGQITSDQL 101
            |:|.:.:.|  :..|...:|  :..:.|:.|:. |.||...:..|.|..:::.|..|....:.: 
pombe    21 DKKSQSLEE--HEKKVQQKN--EELEKKAADKI-SRDELPEKQLAQSNDKDKHSVSNPPHKTLK- 79

  Fly   102 SSLLRGASKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRIP----KKRRGGFAFVEMADLS 162
            |...:|.:...:.:|:|.||..:::.:.|:|||..||.|.|:|||    ..|:.|:||||..:..
pombe    80 SKRQKGKNNDRKVILFVGNLPKDSSVETLQLHFKRAGQVPSVRIPTDKTSGRQKGYAFVEFINPK 144

  Fly   163 S--FQNAFQLHNTELQGRNIKVQISEAGKKKSANKKNIIKQKNRK-LAEMRNEQKTFTKSGKFYD 224
            :  ...|.:.|:|..:.|.|.::::..|..|:..:.|.||:|||| ..|||  |:..::      
pombe   145 TDVISKALKFHHTIYKERKINIELTAGGGGKTEARMNKIKEKNRKWKEEMR--QRVASE------ 201

  Fly   225 KDLKKEKAKEMLARK 239
               :::..:|.:|||
pombe   202 ---EQQAGEEKMARK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 26/75 (35%)
SPBC365.04cNP_596033.1 RRM 18..229 CDD:223796 59/210 (28%)
RRM_Nop6 92..167 CDD:240846 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1937
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto102018
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.