DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and RBM34

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens


Alignment Length:189 Identity:53/189 - (28%)
Similarity:93/189 - (49%) Gaps:28/189 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DDEAAAEGSAASGAEEEESAENGQITSDQLSSLLRGASKTNRHVLYVTNLNFETTKDDLELHFSA 136
            ::.||.:....:||   :.|:..:|..|..|.    .|..::..::|.||.::..:..:|.||..
Human   252 EESAATQALKRNGA---QIADGFRIRVDLASE----TSSRDKRSVFVGNLPYKVEESAIEKHFLD 309

  Fly   137 AGTVKSIRIPK-KRRG---GFAFVEMADLSSFQNAFQLHNTELQGRNIKVQISEAGKKKSANKKN 197
            .|::.::||.: |..|   ||.:|...:..|...|.:|:|:||.||.::|.       :|.||:.
Human   310 CGSIMAVRIVRDKMTGIGKGFGYVLFENTDSVHLALKLNNSELMGRKLRVM-------RSVNKEK 367

  Fly   198 IIKQKNRKLAEMRNEQK-----TFT-KSGKFYDKDL-KKEKAKEMLARKRWRKKPAPRP 249
             .||:|.. ..::|..|     .|| |:.:.:.|.| ..|||..:..:|:.:|| :.||
Human   368 -FKQQNSN-PRLKNVSKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKK-SGRP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 23/73 (32%)
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153
RRM 176..>382 CDD:223796 39/145 (27%)
RRM1_RBM34 185..276 CDD:240840 6/26 (23%)
RRM2_RBM34 288..360 CDD:240841 22/71 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..395 9/31 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..430 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2864
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.