DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and rbm-34

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_502291.1 Gene:rbm-34 / 178148 WormBaseID:WBGene00008688 Length:394 Species:Caenorhabditis elegans


Alignment Length:334 Identity:70/334 - (20%)
Similarity:115/334 - (34%) Gaps:134/334 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RREIFEGTYVDKEDGRNPSDPEDSKSEDEAKSDDEAAAEGSAASGAEEEESAEN----------- 93
            :.|:.:|..|.::..|...||: .|:|:|..:|..||||..|.....||:..||           
 Worm    61 QEEVVKGDKVIEKPKRRKYDPK-KKAEEEKAADAAAAAEEVAPETEGEEKKDENKEGKRDRTKQR 124

  Fly    94 ------------------------------------------GQITSDQLSSLLRGASKTNRHV- 115
                                                      |.|:|.::.:||....|..:.| 
 Worm   125 ENRTLQKSNARASAAENALTVFVGNMPLTMNEKSVRRIFSDFGTISSVRMRNLLPANEKLTKRVT 189

  Fly   116 ----------------------------------------------------------LYVTNLN 122
                                                                      ::|.||.
 Worm   190 HLTGKLNDKQSSLTFYVKFGAEESVEKALKYNGTKLDDHVIRVDKVGSKKKEFGKDMAIFVGNLP 254

  Fly   123 FETTKDDLELHFSA-AGTVKSIRIPKKR---RG-GFAFVEMADLSSFQNAFQLHNTELQGRNIKV 182
            ||.|:|.|...||| .|.|:::||.:.:   :| |||||.....||...|..:...:::.|::::
 Worm   255 FEITEDALITFFSAQIGPVEAVRIVRDKDTGKGKGFAFVNFKQDSSVSLALSMETIKMEKRDLRI 319

  Fly   183 ----------QISEAGKKKSANKK--NIIKQKNRKLAEMRNEQKTFTKSGKFYDKDLKKEKAKEM 235
                      :|..|.|:.|..||  |.|..|..|......:::|..::    |:...|:.||:.
 Worm   320 TKVMKKGHLTKIQTAKKRTSHGKKNQNEITGKLHKFKFSTKKERTTEQN----DRRALKKSAKKA 380

  Fly   236 LARKRWRKK 244
            :|:|:..||
 Worm   381 IAKKKAAKK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 26/143 (18%)
rbm-34NP_502291.1 RRM1_RBM34 144..233 CDD:240840 7/88 (8%)
RRM2_RBM34 247..320 CDD:240841 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2864
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.