DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and sart-3

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_502136.1 Gene:sart-3 / 178053 WormBaseID:WBGene00007111 Length:836 Species:Caenorhabditis elegans


Alignment Length:223 Identity:54/223 - (24%)
Similarity:89/223 - (39%) Gaps:45/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RVQRTVNDDSADLLGNFDDQKRREIFEGTYVDK----EDG--RNPSDPEDSKSEDEAKSDDEAAA 77
            |.|:.|::..|....:..|..::....|..:.|    :||  :.|..|.::||.....|.:   |
 Worm   510 RPQKKVSEKPAPAPKSKQDHIQKRTSGGEPIVKKVKGDDGGFKAPLPPSNAKSSSAVSSSN---A 571

  Fly    78 EGSAASGAEEEESAENGQITSDQLSSLLRGASKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKS 142
            ..:.|.|:...:.|..|  |.|             ...::|:||:|.||:|::.   .|...|.|
 Worm   572 SSTPAPGSFAVQKAAPG--TED-------------ARTIFVSNLDFTTTEDEIR---QAIEGVAS 618

  Fly   143 IRIPKKRRG-----GFAFVEMADLSSFQNAFQLHNTELQGRNIKVQISEAGKKKSANKKNIIKQK 202
            ||..:|...     |||:|.|.:....|.|.......::||.:.:         |||...  |:.
 Worm   619 IRFARKANSDLVHRGFAYVVMENDQKAQQALLKDRVPVKGRPMFI---------SANDPE--KRV 672

  Fly   203 NRKLAEMRNEQKTFTKSGKFY--DKDLK 228
            ..|.:....:.|.|.::..|.  |.:||
 Worm   673 GFKFSTTLEKSKVFVRNVHFQATDDELK 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 22/74 (30%)
sart-3NP_502136.1 RRM_SF 681..761 CDD:418427 6/20 (30%)
Lsm_interact 818..835 CDD:398843
TPR 209..494 CDD:223533
RRM_SF 594..664 CDD:418427 22/81 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.