DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and Rsf1

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_061509636.1 Gene:Rsf1 / 1280099 VectorBaseID:AGAMI1_014631 Length:224 Species:Anopheles gambiae


Alignment Length:84 Identity:27/84 - (32%)
Similarity:44/84 - (52%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GASKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRI---PKKRRGGFAFVEMADLSSFQNAF 168
            |.||..|  :||.||..:..|:|||..|:..|.:.|:.:   |.    ||||:|..:....:.|.
Mosquito     2 GDSKGTR--VYVGNLTDKVKKEDLEGEFTKYGKLNSVWVAFNPP----GFAFIEFENKEEAETAC 60

  Fly   169 -QLHNTELQGRNIKVQISE 186
             .|:..::.|..::|:||:
Mosquito    61 DNLNGQDILGSKLRVEISK 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 27/84 (32%)
RRM 116..187 CDD:440488 23/75 (31%)
Rsf1XP_061509636.1 None

Return to query results.
Submit another query.