DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and SRSF10

DIOPT Version :9

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_473357.1 Gene:SRSF10 / 10772 HGNCID:16713 Length:262 Species:Homo sapiens


Alignment Length:154 Identity:39/154 - (25%)
Similarity:70/154 - (45%) Gaps:34/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LYVTNLNFETTKDDLELHFSAAGTVKSIRIP----KKRRGGFAFVEMADLSSFQNAFQLHNTE-- 174
            |:|.|:..:|..:||...|...|.:..:.:|    .:|..|||:|:..|:...::|  |||.:  
Human    12 LFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDA--LHNLDRK 74

  Fly   175 -LQGRNIKVQISEAGKKKSANKKNIIKQKNRKLAEMRNEQKTFTKSGKFYDKDLKKEKAKEMLAR 238
             :.||.|::|.:: |.:|:.|:   :|.|         |.:....|.::.|.|..:........|
Human    75 WICGRQIEIQFAQ-GDRKTPNQ---MKAK---------EGRNVYSSSRYDDYDRYRRSRSRSYER 126

  Fly   239 KR---------WRKKPAP---RPT 250
            :|         :|:..:|   |||
Human   127 RRSRSRSFDYNYRRSYSPRNSRPT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 22/74 (30%)
SRSF10NP_473357.1 RRM_SF 5..99 CDD:418427 27/92 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..262 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.