DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3594 and RBM7

DIOPT Version :10

Sequence 1:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001272974.1 Gene:RBM7 / 10179 HGNCID:9904 Length:267 Species:Homo sapiens


Alignment Length:124 Identity:35/124 - (28%)
Similarity:57/124 - (45%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ASKTNRHVLYVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRRG---GFAFVEMADLSSFQNAFQ 169
            |::.:| .|:|.||..:.|::.|...|..||.|..::|||.:.|   .||||......|...|..
Human     5 AAEADR-TLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMN 68

  Fly   170 LHN-TELQGRNIKVQISEAGKKKSANKKNIIKQKNRKLAEMRNEQKTFTKSGKFYDKDL 227
            |.| .:|.||.||:|. .:|...:....::...::    .:.|...|.|.....|::.:
Human    69 LLNGIKLYGRPIKIQF-RSGSSHAPQDVSLSYPQH----HVGNSSPTSTSPSSRYERTM 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 31/92 (34%)
RRM 116..187 CDD:440488 28/74 (38%)
RBM7NP_001272974.1 RRM_RBM7 9..83 CDD:410005 28/74 (38%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 25..35 3/9 (33%)
ZCCHC8 binding. /evidence=ECO:0000269|PubMed:27905398, ECO:0007744|PDB:5LXR, ECO:0007744|PDB:5LXY 59..76 4/16 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..267
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.