DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp9 and Cpr78E

DIOPT Version :10

Sequence 1:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:103 Identity:31/103 - (30%)
Similarity:47/103 - (45%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFVIVLACLLAVVFANEEADVVKSDSE--VNLLD----------FNYAY--ELSNHIR--AVQTG 50
            |.:||...|...|..:...|.|.|.::  |.:|:          :|::|  |...|.|  ||...
  Fly     3 KILIVALSLCTAVVLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRN 67

  Fly    51 ALKEHDNWVVSGEYEYVAPNGKTVKVVYTADETGYHPK 88
            ...|::...:||.|.|...||:.|.|.|.||:.|:.|:
  Fly    68 QGTENEYLEISGSYSYFDANGQEVTVTYKADDHGFVPE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:459790 19/54 (35%)
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.