DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp9 and Cpr67Fa1

DIOPT Version :10

Sequence 1:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster


Alignment Length:86 Identity:30/86 - (34%)
Similarity:46/86 - (53%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLACLLAVVFANEEAD--VVKSDSEVNLL-DFNYAYELSNHIRAVQTGALKEHDNWVVSGEYEYV 67
            :|||.......|:||.  :.|..|::... ::||.||.||.|.|.::|....|.|    |.:.:.
  Fly    11 ILACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGIGGNHAN----GGFSWY 71

  Fly    68 APNGKTVKVVYTADETGYHPK 88
            :|.|:.|::.|.|||.||.|:
  Fly    72 SPEGELVQISYVADENGYQPQ 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:459790 19/50 (38%)
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:459790 19/50 (38%)

Return to query results.
Submit another query.