DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp9 and l(3)mbn

DIOPT Version :9

Sequence 1:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster


Alignment Length:86 Identity:20/86 - (23%)
Similarity:34/86 - (39%) Gaps:16/86 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFV--IVLACLLAVVFANEEADVVKSDSEVNLLDFNYAYELSNHIRAVQTGALKEHDNWVVSGE 63
            |.||  ::|.|.|        ..|:.:.:.|....|.:..:...|      .|.|..:..::.||
  Fly     6 MAFVCALLLLCTL--------THVLSAATTVRPYKFGFTIDEQQH------RAEKRDERGIIMGE 56

  Fly    64 YEYVAPNGKTVKVVYTADETG 84
            :.::..:|.....||..||.|
  Fly    57 FGFITADGIYHVTVYATDEEG 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:278791 12/51 (24%)
l(3)mbnNP_729143.2 Chitin_bind_4 31..77 CDD:278791 11/51 (22%)
Chitin_bind_4 575..621 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.