DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp9 and Cpr47Ee

DIOPT Version :10

Sequence 1:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:66 Identity:21/66 - (31%)
Similarity:32/66 - (48%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SEVNL-LDFNYAYELSNHIRAVQTGALKE------HDNWVVSGEYEYVAPNGKTVKVVYTADETG 84
            :|:|| ..|:|.|..::...|...|.:|.      .:..|:.|.|.|.:|.|..:.|.|.|||.|
  Fly   112 NELNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENG 176

  Fly    85 Y 85
            :
  Fly   177 F 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:459790 17/56 (30%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:459790 17/56 (30%)

Return to query results.
Submit another query.