DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp9 and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:99 Identity:28/99 - (28%)
Similarity:47/99 - (47%) Gaps:14/99 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIVLACLLAVVFA---------NEEADVVKSDSEVNL-LDFNYAYELSNHIRAVQTGALK----E 54
            :.:.|.||::..|         .|...:::.:.|||. ..:.|.||..|.|.|.:.|.||    :
  Fly     6 LFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTD 70

  Fly    55 HDNWVVSGEYEYVAPNGKTVKVVYTADETGYHPK 88
            :...|..|.:.|.:|.|..:::.|.|||.|:.|:
  Fly    71 NAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQ 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:278791 18/54 (33%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.