DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egg and SUVH2

DIOPT Version :9

Sequence 1:NP_611966.3 Gene:egg / 37962 FlyBaseID:FBgn0086908 Length:1262 Species:Drosophila melanogaster
Sequence 2:NP_001318341.1 Gene:SUVH2 / 817892 AraportID:AT2G33290 Length:651 Species:Arabidopsis thaliana


Alignment Length:381 Identity:90/381 - (23%)
Similarity:135/381 - (35%) Gaps:129/381 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   893 PSIVKDT-----DISKGQEKMAIPLVN------------YYDNTLPPPCTYAKQRIPTEGVHLNL 940
            ||:|:.|     |:|..:|.:.:.|.|            |....:.||..:.:..|...|     
plant   376 PSMVRPTGYVSFDLSNKKENVPVFLYNDVDGDQEPRHYEYIAKAVFPPGIFGQGGISRTG----- 435

  Fly   941 DEEFLLCCDCEDDCSDKSKCACWQLTVAGVRYCNPKKPIEEIGYQYKRLHEHVPTGIYECNSRCK 1005
                   |:|:..|:|...||         |....:...::.|:..|..|.     ::||...|.
plant   436 -------CECKLSCTDDCLCA---------RKNGGEFAYDDNGHLLKGKHV-----VFECGEFCT 479

  Fly  1006 CKKNCLNRVVQFSLEMKLQVFKTSNRGWGLRCVNDIPKGAFICIYAGHLLT----ETMANEGGQD 1066
            |..:|.:||.|..|..:|:||::...|||:|.::.|..|||||.|||.::|    |.::..|...
plant   480 CGPSCKSRVTQKGLRNRLEVFRSKETGWGVRTLDLIEAGAFICEYAGVVVTRLQAEILSMNGDVM 544

  Fly  1067 AGDEYFADLDYIEVAEQLKEGYESEVDHSDPDAEEDNGGPDAEDDDDF-RPNYHYQRKIKRSSRS 1130
            .....|.|                         :..|.|..::...|| ||||            
plant   545 VYPGRFTD-------------------------QWRNWGDLSQVYPDFVRPNY------------ 572

  Fly  1131 GSTQNSSTQSSELDSQERAVINFNPN-ADLDETVRENSVRRLFGKDEAPYIMDAKTTGNLGRYFN 1194
                                    |: ..||                  :.||.....|:..|.:
plant   573 ------------------------PSLPPLD------------------FSMDVSRMRNVACYIS 595

  Fly  1195 HSCSPNLFVQNVFVDTHDLRFPWVAFFSAAHIRSGTELTWNYNYEVGVVPGKVLYC 1250
            ||..||:.||.|..|.:.|.||.|..|:..:|....||:.:|.. ...|.||:..|
plant   596 HSKEPNVMVQFVLHDHNHLMFPRVMLFALENISPLAELSLDYGL-ADEVNGKLAIC 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eggNP_611966.3 HMT_MBD 823..879 CDD:238689
Pre-SET 901..1013 CDD:282838 24/123 (20%)
SET 1022..1239 CDD:214614 53/222 (24%)
SUVH2NP_001318341.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X219
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.