DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egg and CG4565

DIOPT Version :9

Sequence 1:NP_611966.3 Gene:egg / 37962 FlyBaseID:FBgn0086908 Length:1262 Species:Drosophila melanogaster
Sequence 2:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster


Alignment Length:388 Identity:88/388 - (22%)
Similarity:128/388 - (32%) Gaps:144/388 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   875 DNFDFTPDLKCLAEYSIDPSIVKDTDISKGQEKMAIPLVNYYDNTLPPPCTYAKQRIPTEGVHLN 939
            |:::....|..:.|     |::..:|.||..:.:|    :.|::.|..|                
  Fly    10 DDYEHPDGLDYILE-----SVLMPSDGSKEFKFLA----DEYNSVLLNP---------------- 49

  Fly   940 LDEEFLLCCDCEDDCSDKSKCACWQLTVAGVRYCNPKKPIEEIGYQYKRLHEHVPTGIYECNSRC 1004
                    |.|:..|.:...||      .|.:|     ...|.|.:....:...|  :.|||..|
  Fly    50 --------CHCKGACENSEVCA------HGGQY-----EFTEDGSELILRNSANP--VIECNDMC 93

  Fly  1005 KCKKN-CLNRVVQFSLEMKLQVFKTSNRG-WGLRCVNDIPKGAFICIYAGHLLTETMANEGGQDA 1067
            ||.:| |.||:|.......|::|.:...| .|||....|.||.:||.|||.|||...|.....| 
  Fly    94 KCCRNTCSNRLVYSGPRKHLEIFDSPVYGSKGLRTTAKITKGGYICEYAGELLTVPEARSRLHD- 157

  Fly  1068 GDEYFADLDYIEVAEQLKEGYESEVDHSDPDAEEDNGGPDAEDDDDFRPNYHYQRKIKRSSRSGS 1132
             :|....::||.|..:    |.|:                                         
  Fly   158 -NEKLGLMNYILVLNE----YTSD----------------------------------------- 176

  Fly  1133 TQNSSTQSSELDSQERAVINFNPNADLDETVRENSVRRLFGKDEAPYIMDAKTTGNLGRYFNHSC 1197
                                                     |.:...|:|....||:|||.||||
  Fly   177 -----------------------------------------KKQQVTIVDPSRRGNIGRYLNHSC 200

  Fly  1198 SPNLFVQNVFVDTHDLRFPWVAFFSAAHIRSGTELTWNYNYE---VGVVPGKVLYCQCGAPNC 1257
            .||..:..|.:   |...|.:..|:|..|.:..||.::|..|   ..:..||.  |.|||..|
  Fly   201 EPNCHIAAVRI---DCPIPKIGIFAARDIAAKEELCFHYGGEGQYKKMTGGKT--CLCGASKC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eggNP_611966.3 HMT_MBD 823..879 CDD:238689 1/3 (33%)
Pre-SET 901..1013 CDD:282838 24/112 (21%)
SET 1022..1239 CDD:214614 48/217 (22%)
CG4565NP_001097743.1 Pre-SET 10..103 CDD:282838 29/138 (21%)
SET 111..239 CDD:214614 48/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.