DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egg and EZH1

DIOPT Version :9

Sequence 1:NP_611966.3 Gene:egg / 37962 FlyBaseID:FBgn0086908 Length:1262 Species:Drosophila melanogaster
Sequence 2:NP_001308008.1 Gene:EZH1 / 2145 HGNCID:3526 Length:753 Species:Homo sapiens


Alignment Length:676 Identity:132/676 - (19%)
Similarity:219/676 - (32%) Gaps:247/676 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   612 DFIQKYVEKYSVDRPMV---QCT------------RGQSMTTESNGTWLYARVIDIDCSLVLMQF 661
            |..::|.|...:..|..   |||            |.||:  .|..|....|....||.|     
Human   258 DMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSL--HSFHTLFCRRCFKYDCFL----- 315

  Fly   662 EGDKNHTEWIYRGSLRLGPVFRETQNNMNSSSAQQLRV---PRRTEPFIRYTKEMESSSKVNQQM 723
                 |.             |..|. |:.....:::::   |..|:.|:......|.:...|.:.
Human   316 -----HP-------------FHATP-NVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRS 361

  Fly   724 RAFARKS------SASAQNNALAAASSAATPAGGRT--NAGGVSTSNSASAVRHLNNSTIYVDDE 780
            :...|:.      |||..|   |:||:.|....|.:  :.|....|:|:.|     ||......:
Human   362 KCSGRRRRRHHIVSASCSN---ASASAVAETKEGDSDRDTGNDWASSSSEA-----NSRCQTPTK 418

  Fly   781 NRPKGHVVYFTAKRNLPPKMYKCHECSPN----------CLFKIVH--RLDSYSPLAKPLLSGWE 833
            .:..          ..||::  |...:|:          .||::.|  ..:::..:|:.|.:...
Human   419 QKAS----------PAPPQL--CVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTC 471

  Fly   834 RLVMRQKTKKSVVYKGPCGKSLRSLAEVHRYLRATENVLNVDNFDFTPDLKCLAEYSIDPSIVKD 898
            :.|.:...|:|::.|.|                 |:.::|       |..|...::.:..:..:.
Human   472 KQVFQFAVKESLILKLP-----------------TDELMN-------PSQKKKRKHRLWAAHCRK 512

  Fly   899 TDISKGQEKMAIPLVNYYDNTLPP-PCTYAKQRIPTEGVHLNLDEEFLLC----------CDCED 952
            ..:.|  :..:..:.||.....|. ||......|.|:    |..|:|..|          |.|:.
Human   513 IQLKK--DNSSTQVYNYQPCDHPDRPCDSTCPCIMTQ----NFCEKFCQCNPDCQNRFPGCRCKT 571

  Fly   953 DCSDKSKCACWQLTVAGVRYCNPKKPIEEIGYQYKRLHEHVPTGIYECNSRCKCKKNCLNRVVQF 1017
            .|:.| :|.|:    ..||.|:|...: ..|     ..||....:..|       |||   .:|.
Human   572 QCNTK-QCPCY----LAVRECDPDLCL-TCG-----ASEHWDCKVVSC-------KNC---SIQR 615

  Fly  1018 SLEMKLQVFKTSNRGWGLRCVNDIPKGAFICIYAGHLLTETMANEGGQDAGDEYFADLDYIEVAE 1082
            .|:..|.:..:...|||......:.|..||..|.|.|:::..|:..|: ..|:|           
Human   616 GLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGK-VYDKY----------- 668

  Fly  1083 QLKEGYESEVDHSDPDAEEDNGGPDAEDDDDFRPNYHYQRKIKRSSRSGSTQNSSTQSSELDSQE 1147
                                                                    .||.|    
Human   669 --------------------------------------------------------MSSFL---- 673

  Fly  1148 RAVINFNPNADLDETVRENSVRRLFGKDEAPYIMDAKTTGNLGRYFNHSCSPNLFVQNVFVDTHD 1212
                 ||.|.|                    :::||...||..|:.|||.:||.:.:.|.|: .|
Human   674 -----FNLNND--------------------FVVDATRKGNKIRFANHSVNPNCYAKVVMVN-GD 712

  Fly  1213 LRFPWVAFFSAAHIRSGTELTWNYNY 1238
            .|   :..|:...|::|.||.::|.|
Human   713 HR---IGIFAKRAIQAGEELFFDYRY 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eggNP_611966.3 HMT_MBD 823..879 CDD:238689 9/55 (16%)
Pre-SET 901..1013 CDD:282838 29/122 (24%)
SET 1022..1239 CDD:214614 42/217 (19%)
EZH1NP_001308008.1 EZH2_WD-Binding 45..73 CDD:288468
SANT 439..480 CDD:238096 6/40 (15%)
SANT 439..480 CDD:197842 6/40 (15%)
SET <469..733 CDD:225491 80/415 (19%)
SET 619..740 CDD:214614 42/218 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.