DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egg and Kmt2b

DIOPT Version :9

Sequence 1:NP_611966.3 Gene:egg / 37962 FlyBaseID:FBgn0086908 Length:1262 Species:Drosophila melanogaster
Sequence 2:XP_038949797.1 Gene:Kmt2b / 102550344 RGDID:7678027 Length:2714 Species:Rattus norvegicus


Alignment Length:125 Identity:39/125 - (31%)
Similarity:53/125 - (42%) Gaps:29/125 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1156 NADLDETVRENS---VRRLF---------GKDEAPY--------IMDAKTTGNLGRYFNHSCSPN 1200
            |.|..|.|.|.|   :|.:.         ||....|        ::||...||..|:.||||.||
  Rat  2593 NIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPN 2657

  Fly  1201 LFVQNVFVD--THDLRFPWVAFFSAAHIRSGTELTWNYNYEVGVVPGKVLYCQCGAPNCR 1258
            .|.:.:.|:  .|      :..|:...|..|.|||::|.:.:.....| |.|.|||..||
  Rat  2658 CFSRVIHVEGQKH------IVIFALRRILRGEELTYDYKFPIEDASNK-LPCNCGAKRCR 2710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eggNP_611966.3 HMT_MBD 823..879 CDD:238689
Pre-SET 901..1013 CDD:282838
SET 1022..1239 CDD:214614 31/104 (30%)
Kmt2bXP_038949797.1 zf-CXXC 956..1003 CDD:366873
PHD1_KMT2B 1202..1248 CDD:277064
PHD2_KMT2B 1250..1299 CDD:277066
PHD3_KMT2B 1336..1392 CDD:277068
Bromo_ALL-1 1373..1515 CDD:99925
ePHD_KMT2B 1580..1684 CDD:277164
FYRN 1732..1779 CDD:399155
PHA03247 <1807..2315 CDD:223021
FYRC 2412..2496 CDD:197781
SET_KMT2A_2B 2561..2714 CDD:380947 39/125 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.