DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eps-15 and TPM1

DIOPT Version :9

Sequence 1:NP_611965.2 Gene:Eps-15 / 37961 FlyBaseID:FBgn0035060 Length:1253 Species:Drosophila melanogaster
Sequence 2:NP_014320.1 Gene:TPM1 / 855645 SGDID:S000005023 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:50/227 - (22%)
Similarity:102/227 - (44%) Gaps:41/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 EVKPTYSNPELEMIS--KEIEELARERRVLETEIAQKEADVR---IKNGEVRSLQSELDTLTATL 473
            :::...||.:||..|  ::.|||..:.:.||.|..:||..::   :||   :.|:.|::.|.|.|
Yeast     3 KIREKLSNLKLEAESWQEKYEELKEKNKDLEQENVEKENQIKSLTVKN---QQLEDEIEKLEAGL 64

  Fly   474 ---KQLENQRGEAQKRLDDLQAQVSHNTAVLANVSLDISRTNEQVTKIRDQCHMQEVTINEQEGE 535
               ||.|....|.:.::..|..: :|             :..|::.|:..:. .:...::|....
Yeast    65 SDSKQTEQDNVEKENQIKSLTVK-NH-------------QLEEEIEKLEAEL-AESKQLSEDSHH 114

  Fly   536 LNAKRSELQKLKDEEASLQKEYDSNNRELSKLTNHLQATQLQISSVRSMVTQLLETQRQMTDALL 600
            |.:......| |:::  |:::.:.::.:|.:.|..|:.:.|:...:...|. .||.||:      
Yeast   115 LQSNNDNFSK-KNQQ--LEEDLEESDTKLKETTEKLRESDLKADQLERRVA-ALEEQRE------ 169

  Fly   601 ICRAAMENQNAELVSEYQLKIEPDFDEARKTL 632
                ..|.:|.||..:|: ..:.:.||...:|
Yeast   170 ----EWERKNEELTVKYE-DAKKELDEIAASL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eps-15NP_611965.2 EH 16..82 CDD:238009
EH 126..215 CDD:197477
EH 137..202 CDD:238009
EH 307..402 CDD:197477
EH 318..384 CDD:238009
RILP-like <445..548 CDD:304877 20/108 (19%)
Spc24 529..>584 CDD:285486 9/54 (17%)
TPM1NP_014320.1 Tropomyosin_1 7..186 CDD:403808 47/211 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.721928 Normalized mean entropy S4078
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.