DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Eps-15 and ehd2a

DIOPT Version :9

Sequence 1:	NP_611965.2	Gene:	Eps-15 / 37961	FlyBaseID:	FBgn0035060	Length:	1253	Species:	Drosophila melanogaster
Sequence 2:	XP_017211861.1	Gene:	ehd2a / 567055	ZFINID:	ZDB-GENE-060531-86	Length:	546	Species:	Danio rerio

Alignment Length:	143	Identity:	48/143 - (33%)
Similarity:	70/143 - (48%)	Gaps:	21/143 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    79 LSQAGQVASMANIYLDIANP----PKLGELPKTMPSRIQTVPVASGGVANGDWSIGVIDRLKYEQ 139
            |.|.|.:.|....:: :.||    ...||:.:               .:|.:|.:.. |:.||::
Zfish   407 LIQGGPLGSHRGPFI-VGNPFHHSGSNGEIDQ---------------ASNDEWVVSK-DKAKYDE 454

  Fly   140 LFESLHPSNGMLPGNKVKGVLMDSKLPMSILGTIWDLADQDKDGNLDMHEFVVAMHLVYQTLQKR 204
            :|.:|.|..|.|.|.|||..::.:.||.|:||.||.|||.|.||.||..||.:|.||:...|:..
Zfish   455 IFYNLSPHEGKLTGTKVKEWMLRTHLPSSVLGRIWKLADVDCDGKLDDEEFALAGHLIEVKLEGF 519

  Fly   205 TIPSVLPPELRKP 217
            .:|..||..|..|
Zfish   520 GLPHELPTHLLPP 532

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Eps-15	NP_611965.2	EH	16..82	CDD:238009	1/2 (50%)
		EH	126..215	CDD:197477	37/88 (42%)
		EH	137..202	CDD:238009	30/64 (47%)
		EH	307..402	CDD:197477
		EH	318..384	CDD:238009
		RILP-like	<445..548	CDD:304877
		Spc24	529..>584	CDD:285486
ehd2a	XP_017211861.1	EHD_N	23..55	CDD:293485
		EHD	59..299	CDD:206740
		EH	442..535	CDD:197477	39/92 (42%)
		EH	452..517	CDD:238009	30/64 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170589266
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.840