DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and CLIC3

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:200 Identity:47/200 - (23%)
Similarity:68/200 - (34%) Gaps:58/200 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LLKGEHLT---------PEFLK-LNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQQLYPKE 90
            ||||...|         |:.|| ..|...:|.|:.......|:..|..:|.|..|..:   :| .
Human    33 LLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPD---FP-S 93

  Fly    91 LVQRANVDARLHLDSGHLFARLRFLYEPI------LYYGSTDCSIDKIAYIQKCWEILEGFLKDQ 149
            |..|.........|..|.|:  .|:..|:      ||...........:|::   ..||..|..:
Human    94 LAPRYRESNTAGNDVFHKFS--AFIKNPVPAQDEALYQQLLRALARLDSYLR---APLEHELAGE 153

  Fly   150 P--------YLCGSDLTIADFCAVATVTSVNDT-------API-----------------DEFKF 182
            |        :|.|..||:|| |::.....:.||       |||                 .|||:
Human   154 PQLRESRRRFLDGDRLTLAD-CSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKY 217

  Fly   183 PKMHA 187
            ...|:
Human   218 TCPHS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 14/50 (28%)
GstA 6..201 CDD:223698 47/199 (24%)
GST_C_Delta_Epsilon 92..210 CDD:198287 29/133 (22%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 15/54 (28%)
PLN02817 5..229 CDD:330276 47/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.