DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GTT1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:48/223 - (21%)
Similarity:78/223 - (34%) Gaps:55/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SRA--VLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTL-IDGEAT-----IIDSHAI 71
            |||  :|.....:.|:.|:.|..........||..|::|....|.| :....|     :.:|..|
Yeast    14 SRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDRETGKKKILAESGFI 78

  Fly    72 CAYLVEKYGQK---------------------EQQLYPKELVQRANVDARLHLDSGHLFARLRFL 115
            ..|:::.:...                     |..|.|..:::......:   |||..|      
Yeast    79 FQYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVK---DSGMPF------ 134

  Fly   116 YEPILYYGSTDCSIDKI--AY----IQKCWEILEGFL-KDQPYLCGSDLTIADFCAVATVTSVND 173
              ||.|....  ..|||  ||    ::..::.:||.: |:..||....|:.||......:....:
Yeast   135 --PISYLARK--VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFPLQMAFE 195

  Fly   174 ---TAPIDEFKFPKMHAWLKRLAELPYY 198
               .||.|   :|.:..|||.:.....|
Yeast   196 RKFAAPED---YPAISKWLKTITSEESY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 17/69 (25%)
GstA 6..201 CDD:223698 48/223 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 28/117 (24%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 17/72 (24%)
GST_C_GTT1_like 93..218 CDD:198298 30/140 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.