DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and YGR201C

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:40/167 - (23%)
Similarity:71/167 - (42%) Gaps:25/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PQHTIPTLI--DGEATIIDSHAICAYLVEKYGQKE---QQLYPK-ELVQRANVDARLHLDSGHLF 109
            |....||.:  ..|.|:.::.||..||:.....||   |.|.|: :...||::.....|.:....
Yeast    49 PLRKYPTFVGPHDEWTLTEAMAIDYYLIHLSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFL 113

  Fly   110 ARLRFLYEPIL---YYGSTDC-----SIDKIAYIQKCWEILEGFLKDQPYL-CGSDLTIADFCAV 165
            ..:..::.|::   .|.:|:.     ::|.|.      .:.|..||.|.|| |....|:||..:.
Yeast   114 NEVCEVFFPLIGVKPYNATEFKAARENVDTIV------SLYEKRLKKQQYLVCDDHETLADLISA 172

  Fly   166 ATVTSVNDTAPIDE---FKFPKMHAWLKRLAELPYYQ 199
            |.. |:...:..||   .|.|::..|..|:.:..:::
Yeast   173 AAF-SLGFISFFDETWRSKHPEVTRWFNRVIKSRFFE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 9/27 (33%)
GstA 6..201 CDD:223698 40/167 (24%)
GST_C_Delta_Epsilon 92..210 CDD:198287 26/120 (22%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 9/28 (32%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345087
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.