DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GTT2

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:250 Identity:61/250 - (24%)
Similarity:98/250 - (39%) Gaps:60/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATLSPPSRA---VLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGE 62
            |.:..:.|.|.:.|..|   :.|..|.:...::...|||.||||..||||..|...|:|.|...:
Yeast    15 MKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDD 79

  Fly    63 ATIIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSG--HLF---ARLRFLYEPI--- 119
            .|:|   |.|..:.|         |...|.....:..:..|:.|  |:.   |.|..| :|:   
Yeast    80 GTLI---AECTAITE---------YIDALDGTPTLTGKTPLEKGVIHMMNKRAELELL-DPVSVY 131

  Fly   120 LYYGSTDCSIDKIAYIQKCW------EILEGF------LKDQPYLCGSDLTIADFCAVATVTSVN 172
            .::.:.....:...|..|.|      :.|.|.      |:::||:.|...::||...:|.:.   
Yeast   132 FHHATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLI--- 193

  Fly   173 DTAPIDEFKFPK----MHAWLKRLAELPYYQEVNGDGADELKSIFKAKLAENRGK 223
             .|.|.:.:.|:    :.||.||:.:.|..:                ||.|.|.|
Yeast   194 -FAAIVKLQVPEECEALRAWYKRMQQRPSVK----------------KLLEIRSK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/75 (33%)
GstA 6..201 CDD:223698 55/221 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/141 (19%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 27/86 (31%)
GST_C_GTT2_like 106..222 CDD:198291 27/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345152
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1708
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.