powered by:
Protein Alignment GstE12 and clic3
DIOPT Version :9
Sequence 1: | NP_001246500.1 |
Gene: | GstE12 / 37960 |
FlyBaseID: | FBgn0027590 |
Length: | 223 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_955818.1 |
Gene: | clic3 / 84040 |
ZFINID: | ZDB-GENE-010507-2 |
Length: | 239 |
Species: | Danio rerio |
Alignment Length: | 63 |
Identity: | 19/63 - (30%) |
Similarity: | 25/63 - (39%) |
Gaps: | 13/63 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 LKGEHLT---------PEFLK-LNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQQLYPK 89
|||.:.| ||.|| |.|....|.||.......|::.|..:|.:.....: |||
Zfish 35 LKGVNFTLTTVDMKRAPEVLKDLAPGSQPPFLIYNGEVRTDTNKIEEFLEDTLAPPQ---YPK 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170589619 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.