DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and clic3

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:63 Identity:19/63 - (30%)
Similarity:25/63 - (39%) Gaps:13/63 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LKGEHLT---------PEFLK-LNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKEQQLYPK 89
            |||.:.|         ||.|| |.|....|.||.......|::.|..:|.:.....:   |||
Zfish    35 LKGVNFTLTTVDMKRAPEVLKDLAPGSQPPFLIYNGEVRTDTNKIEEFLEDTLAPPQ---YPK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 16/49 (33%)
GstA 6..201 CDD:223698 19/63 (30%)
GST_C_Delta_Epsilon 92..210 CDD:198287
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 16/59 (27%)
O-ClC 6..237 CDD:129941 19/63 (30%)
GST_C_CLIC3 99..231 CDD:198332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.