DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTF5

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:227 Identity:49/227 - (21%)
Similarity:94/227 - (41%) Gaps:29/227 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            :|....|..:|.||......||..:...:||:.|:...|.||.:||...:|..:||...:.:|.|
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRA 130

  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLR-FLYEPI------------LYY 122
            |..|:...:..:..||        .|..:...:.:..::..:. |.::|:            :|.
plant   131 ISEYIATVHKSRGTQL--------LNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMYG 187

  Fly   123 GSTDCSI--DKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEF-KFPK 184
            ..||..:  :..|.::|..:|.|..||:..:|..:..|:||...:..:..:.||.....| ..|.
plant   188 LKTDYKVVNETEAKLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNIQYLMDTHTKRMFVNRPS 252

  Fly   185 MHAWLKRLAELPYYQEVNGDGADELKSIFKAK 216
            :..|:..:...|.::.     |.::|:.:..|
plant   253 VRRWVAEITARPAWKR-----ACDVKAWYHKK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/70 (31%)
GstA 6..201 CDD:223698 46/210 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 23/133 (17%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 22/69 (32%)
GST_C_Phi 153..270 CDD:198296 21/121 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.