DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTF4

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:224 Identity:54/224 - (24%)
Similarity:84/224 - (37%) Gaps:40/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLV 76
            |..:|.||.......|..|...:.|..|||.|..||.|||...:|...||...:.:|.||..|:.
plant    45 STNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQYIA 109

  Fly    77 EKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARL----------------RFLYEPIL--YYG 123
            ..:..:..||              |:|.|....|.|                :..:|.::  .||
plant   110 YVHSSRGTQL--------------LNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIYG 160

  Fly   124 -STDCSI--DKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEF-KFPK 184
             .||.:|  :..|.::|...|.|..|::..:|..:..|:.|...:..:..:..|.....| |..|
plant   161 LETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQYLLGTPTKKLFEKRSK 225

  Fly   185 MHAWLKRLAELPYYQEVNGDGADELKSIF 213
            :..|:..:..    :|......|:.||.|
plant   226 VRKWVDEITS----REAWKMACDQEKSWF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 23/64 (36%)
GstA 6..201 CDD:223698 49/210 (23%)
GST_C_Delta_Epsilon 92..210 CDD:198287 26/139 (19%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 23/63 (37%)
GST_C_Phi 126..243 CDD:198296 22/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.