DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTT2

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:233 Identity:62/233 - (26%)
Similarity:104/233 - (44%) Gaps:30/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIID 67
            |..:|...:|.||||||:..|...:..:...|:|.|.:.|:|||.::||...:|.::||...:.:
plant     2 KLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFE 66

  Fly    68 SHAICAYLVEKYGQKEQQLYPKELVQRANVDARL---HLD-----SGH-----LFARLRFLYEPI 119
            ||||..||...|.......||.:|.:||.:.:.|   |.:     ||:     |...|.....|.
plant    67 SHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNPK 131

  Fly   120 LYYGSTDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKF-- 182
            ....:.:...:.::.::..|  |:|..|.  .|.|...:|||...|..:..:......|..:.  
plant   132 AAAEAENILTNSLSTLETFW--LKGSAKF--LLGGKQPSIADLSLVCELMQLQVLDDKDRLRLLS 192

  Fly   183 --PKMHAWLK--RLAELPYYQEVNGDGADELKSIFKAK 216
              .|:..|::  |.|.:|:..||:       :.:|:||
plant   193 PHKKVEQWIESTRKATMPHSDEVH-------EVLFRAK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GstA 6..201 CDD:223698 56/213 (26%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/136 (20%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 27/74 (36%)
GST_C_Theta 92..221 CDD:198292 27/139 (19%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.