DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTT1

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:237 Identity:65/237 - (27%)
Similarity:107/237 - (45%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATI 65
            |.|..:|...:|.|||||::..|..|:..:...|:|.|.:.|:|||..:||...:|.::||...:
plant     1 MMKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKL 65

  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLH--LDSGHLFAR-------LRFLYEPILY 121
            .:||||..||...:.......||.:|.:|    |::|  ||..|...|       |..:..|.| 
plant    66 FESHAILIYLSSAFPSVADHWYPNDLSKR----AKIHSVLDWHHTNLRRGAAGYVLNSVLGPAL- 125

  Fly   122 YG---STDCSIDKIAYIQKCWEILEGF-LK-DQPYLCGSDL-TIADFCAVATVTSVNDTAPIDEF 180
             |   :...:.:....:.|....||.| || :..:|.||:. :|||...|..:..:......|..
plant   126 -GLPLNPKAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRL 189

  Fly   181 KF----PKMHAWLK--RLAELPYYQEVNGDGADELKSIFKAK 216
            :.    .|:..|::  :.|.:|::.|.:       :.:||.|
plant   190 RLLSTHKKVEQWIENTKKATMPHFDETH-------EILFKVK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GstA 6..201 CDD:223698 59/215 (27%)
GST_C_Delta_Epsilon 92..210 CDD:198287 30/138 (22%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 27/74 (36%)
GST_C_Theta 93..223 CDD:198292 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.