DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTF12

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:210 Identity:48/210 - (22%)
Similarity:87/210 - (41%) Gaps:29/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAY 74
            |.:.|.| |||.....|::.|:..|:|...|...||.|...|...:|.:.||:..:.:|.||..|
plant    10 TAACPQR-VLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARY 73

  Fly    75 LVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIAYIQKC- 138
            ...|:..:...|..|.|..||.||....:::.:    ...|.:|::..     .|.|....:|| 
plant    74 YATKFADQGTNLLGKSLEHRAIVDQWADVETYY----FNVLAQPLVIN-----LIIKPRLGEKCD 129

  Fly   139 --------------WEILEGFLKDQPYLCGSDLTIADFC---AVATVTSVNDTAPIDEFKFPKMH 186
                          .:|....|....:|.|.:.|:||..   |:..:.|:.|...:.:.: ...:
plant   130 VVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMVKAR-GSFN 193

  Fly   187 AWLKRLAELPYYQEV 201
            .|.:.:::.|.::::
plant   194 RWWEEISDRPSWKKL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/66 (33%)
GstA 6..201 CDD:223698 48/208 (23%)
GST_C_Delta_Epsilon 92..210 CDD:198287 22/128 (17%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 48/210 (23%)
GST_N_Phi 2..77 CDD:239351 22/67 (33%)
GST_C_Phi 91..209 CDD:198296 22/128 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.