DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTF2

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:200 Identity:53/200 - (26%)
Similarity:94/200 - (47%) Gaps:16/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKY 79
            :|.||:......||.||..:.|..|||....||..||...:|...||:..:.:|.||..|:..:|
plant    15 TRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRY 79

  Fly    80 ---GQKEQQLYPKELVQRANVDARLHLDSGHLF----ARLRF--LYEPILYYG-STDCSI--DKI 132
               |....|...|.:.|.|.:...:.::. |.|    ::|.|  :::.|  || :||.::  ::.
plant    80 ENQGTNLLQTDSKNISQYAIMAIGMQVED-HQFDPVASKLAFEQIFKSI--YGLTTDEAVVAEEE 141

  Fly   133 AYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEF-KFPKMHAWLKRLAELP 196
            |.:.|..::.|..||:..||.|...|:.|...:..:..:..|.....| :.|:::.|:..:.:.|
plant   142 AKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRP 206

  Fly   197 YYQEV 201
            ..::|
plant   207 ASEKV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/61 (36%)
GstA 6..201 CDD:223698 52/198 (26%)
GST_C_Delta_Epsilon 92..210 CDD:198287 26/119 (22%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 22/62 (35%)
GST_C_Phi 96..211 CDD:198296 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.