DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:213 Identity:57/213 - (26%)
Similarity:87/213 - (40%) Gaps:24/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
            ||...:|.....|||.......:.||.|:||....|..|.||.:||...:|.|.|.:.|:.:|.|
plant     5 LYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRA 69

  Fly    71 ICAYLVEKYGQKEQQLY----PKE-LVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSI- 129
            |.||:.||:..|...|.    ||| .:.:...:...|..:..:.|.:..|....|...|.:.:| 
plant    70 ITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQLIVVPLQGESPNAAIV 134

  Fly   130 -DKIAYIQKCWEILEGFLKDQPYLCGSDLTIAD---------FCAVATVTSVNDTAPIDEFKFPK 184
             :.:..:.|..::.|..|....||.|...|:||         |........:||.        |.
plant   135 EENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIHAGLINDR--------PN 191

  Fly   185 MHAWLKRLAELPYYQEVN 202
            :.||.:.|...|.:.:|:
plant   192 VKAWWEDLCSRPAFLKVS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 26/70 (37%)
GstA 6..201 CDD:223698 56/210 (27%)
GST_C_Delta_Epsilon 92..210 CDD:198287 24/122 (20%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 56/211 (27%)
GST_N_Phi 2..77 CDD:239351 26/71 (37%)
GST_C_Phi 92..208 CDD:198296 25/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.