DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTF11

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:203 Identity:45/203 - (22%)
Similarity:85/203 - (41%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEK 78
            |.| |||......::.|:..::|.|.|...|:.|...|...:|.:.||...:.:|.||..|...|
plant    14 PQR-VLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATK 77

  Fly    79 YGQKEQQLYPKELVQRANVDARLHLDSGHLFA-----RLRFLYEPILYYGSTDCSIDKIAYIQ-- 136
            |..:...|..|.|..||.||..:.:::.:.:|     .:..:::|   .....|.:..:..::  
plant    78 YADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKP---KSGKPCDVALVEELKVK 139

  Fly   137 --KCWEILEGFLKDQPYLCGSDLTIADFC------AVATVTSVNDTAPIDEFKFPKMHAWLKRLA 193
              |..::.|..|....||.|.:.|:||..      .:...||::......|    .::.|...::
plant   140 FDKVLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLVTSRE----NLNRWWNEIS 200

  Fly   194 ELPYYQEV 201
            ..|.::::
plant   201 ARPAWKKL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/62 (31%)
GstA 6..201 CDD:223698 45/201 (22%)
GST_C_Delta_Epsilon 92..210 CDD:198287 21/125 (17%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 45/203 (22%)
GST_N_Phi 2..77 CDD:239351 19/63 (30%)
GST_C_Phi 91..209 CDD:198296 21/125 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.