DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTF8

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:214 Identity:55/214 - (25%)
Similarity:101/214 - (47%) Gaps:18/214 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATI 65
            |:...::...:|..:..||.|.....|..||.|:::..|.|.....|.|||...||.|.||:.|:
plant    49 MASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTL 113

  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQ-RANVDARLHLDSGHLF----ARLRFLYEPILYYGST 125
            .:|.||..||.|:|.:|.::|..::..: :|..:..|.:: |..|    ::|.|   ..::.|..
plant   114 FESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVE-GQQFDPNASKLAF---ERVFKGMF 174

  Fly   126 DCSIDKIAY------IQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSV--NDTAPIDEFKF 182
            ..:.|..|.      :||..::.|..|....:|.|...|:||...:..:..:  .|:..:.:.: 
plant   175 GMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDSR- 238

  Fly   183 PKMHAWLKRLAELPYYQEV 201
            ||:..|:|:::..|.:.:|
plant   239 PKVSEWIKKISARPAWAKV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/72 (35%)
GstA 6..201 CDD:223698 53/207 (26%)
GST_C_Delta_Epsilon 92..210 CDD:198287 25/123 (20%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.