DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE12 and GSTF10

DIOPT Version :9

Sequence 1:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:216 Identity:56/216 - (25%)
Similarity:98/216 - (45%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAIC 72
            ||.|...|:..::|....|:..|...::|:|||...||:|.:.|...||.|:||:..|.:|.||.
plant     6 YAPLFASSKRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIM 70

  Fly    73 AYLVEKYGQKEQQLYPKELVQRANVDARLHLD--SGH---LFARLRFLYEPILYYGSTDCSI--- 129
            .|:.|||..:...|..|.:.:|..|:..|.::  |.|   |...|..::.|::.:.:.:..|   
plant    71 RYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKVIKES 135

  Fly   130 -DKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEF---KFPKMH---- 186
             :|:|.:   .::.|..|....||.|..:::||...:          |..|:   ...|.|    
plant   136 EEKLAEV---LDVYEAQLSKNEYLAGDFVSLADLAHL----------PFTEYLVGPIGKAHLIKD 187

  Fly   187 -----AWLKRLAELPYYQEVN 202
                 ||..:::....::||:
plant   188 RKHVSAWWDKISSRAAWKEVS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/68 (37%)
GstA 6..201 CDD:223698 54/213 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 26/132 (20%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 56/216 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.