Sequence 1: | NP_001246500.1 | Gene: | GstE12 / 37960 | FlyBaseID: | FBgn0027590 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001243666.1 | Gene: | GDAP1L1 / 78997 | HGNCID: | 4213 | Length: | 386 | Species: | Homo sapiens |
Alignment Length: | 297 | Identity: | 64/297 - (21%) |
---|---|---|---|
Similarity: | 98/297 - (32%) | Gaps: | 107/297 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70
Fly 71 ICAY-------------------------------LVEKYG--QKEQQLYPKELVQRANVDARLH 102
Fly 103 ---------LDS-----------GHL------FARLRFLYEPILY--YGSTDCSI-------DKI 132
Fly 133 AYIQKCWEILEGFL-----------------KDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEF 180
Fly 181 KF-------------PKMHAWLKRLAELPYYQEVNGD 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE12 | NP_001246500.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 25/101 (25%) |
GstA | 6..201 | CDD:223698 | 61/292 (21%) | ||
GST_C_Delta_Epsilon | 92..210 | CDD:198287 | 34/178 (19%) | ||
GDAP1L1 | NP_001243666.1 | GstA | 47..333 | CDD:223698 | 61/292 (21%) |
GST_N_GDAP1 | 47..119 | CDD:239350 | 24/69 (35%) | ||
GST_C_GDAP1L1 | 220..330 | CDD:198335 | 22/118 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154536 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |